PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00171g00419.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 470aa    MW: 51257.1 Da    PI: 5.5758
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00171g00419.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.71e-165599147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                              r +WT+eE++++v+a k++G   W+ I +++g ++t+ q++s+ qk+
  Peaxi162Scf00171g00419.1 55 REKWTEEEHQRFVEALKLYGRS-WRQIEEHVG-TKTAIQIRSHAQKF 99
                              789*****************55.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.79E-1649103IPR009057Homeodomain-like
PROSITE profilePS5129422.39350104IPR017930Myb domain
TIGRFAMsTIGR015571.4E-1653102IPR006447Myb domain, plants
SMARTSM007173.8E-1354102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-95495IPR009057Homeodomain-like
PfamPF002499.8E-145598IPR001005SANT/Myb domain
CDDcd001673.52E-1057100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MVAEEMNQIE GARQGASSMI SSKLETVAAQ GKALNCLANE NMLKVRKPYT ITKQREKWTE  60
EEHQRFVEAL KLYGRSWRQI EEHVGTKTAI QIRSHAQKFF AKVARDSGID GDESLNAIDI  120
PPPRPKKKPL HPYPRKMVDS PVADKAVSGQ PESSPSPNAS GRDGRSPDSV LSATGSDVFE  180
YAVVEQQPSR FSPASCTTDA QTANIISAEN DESSMTSNSS TVVKIHVASK PVAPNTSPIT  240
NYGMECDLFP RGGSCSGESQ AVEAPLASIK LFGQTVLVPD ATKLKLTLGA PNSCNSLPSK  300
ATEKEINNEN LFHGFQGNQA NSQFIVAMLP GNVIPPVCWS SQYRLENNLE GVAPFPDTVS  360
WWSWYQDLLY RYISSCSQTA METAAPCQAS KDEEPQREGS STGSSVGSAS EVDDGNRSSE  420
TAESKCTTKS DKWNNIKGFV PYKRCLAERD ENSSGVVLEE RESQRVRVCS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016563967.10.0PREDICTED: protein REVEILLE 1-like isoform X2
TrEMBLM1CEP80.0M1CEP8_SOLTU; Uncharacterized protein
STRINGSolyc03g098320.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74472127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.16e-40MYB_related family protein